Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries) Uniprot P13726 33-242 |
Domain d1tfhb2: 1tfh B:107-210 [21962] |
PDB Entry: 1tfh (more details), 2.4 Å
SCOPe Domain Sequences for d1tfhb2:
Sequence, based on SEQRES records: (download)
>d1tfhb2 b.1.2.1 (B:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
>d1tfhb2 b.1.2.1 (B:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqstkvnvtvedertlvntflslrdvfgkdliytlyygkktaktntneflidvd kgcfsvqavipsrtvnrkstdspvecm
Timeline for d1tfhb2: