SCOP 1.75: Domain d1tfha2: 1tfh A:107-211

Lineage for d1tfha2 (1tfh A:107-211)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (12 PDB entries)
   Uniprot P13726 33-242

8. Domain d1tfha2: 1tfh A:107-211 [21960]

Details for d1tfha2

PDB Entry: 1tfh, 2.4 Å

PDB Description: extracellular domain of human tissue factor

PDB Compounds: (A:) human tissue factor

SCOP Domain Sequences for d1tfha2:

Sequence; same for both SEQRES and ATOM records:

>d1tfha2 b.1.2.1 (A:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d1tfha2:

• d1tfha2 first appeared (with stable ids) in SCOP 1.55
  
• d1tfha2 appears in SCOP 1.73
  
• d1tfha2 appears in SCOPe 2.01
  
• d1tfha2 appears in the current release, SCOPe 2.08