Lineage for d1tfha2 (1tfh A:107-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657284Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 657285Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 657299Domain d1tfha2: 1tfh A:107-211 [21960]

Details for d1tfha2

PDB Entry: 1tfh (more details), 2.4 Å

PDB Description: extracellular domain of human tissue factor
PDB Compounds: (A:) human tissue factor

SCOP Domain Sequences for d1tfha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfha2 b.1.2.1 (A:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOP Domain Coordinates for d1tfha2:

Click to download the PDB-style file with coordinates for d1tfha2.
(The format of our PDB-style files is described here.)

Timeline for d1tfha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfha1