| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (14 proteins) |
| Protein Extracellular region of human tissue factor [49267] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) |
| Domain d1tfha2: 1tfh A:107-211 [21960] |
PDB Entry: 1tfh (more details), 2.4 Å
SCOP Domain Sequences for d1tfha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfha2 b.1.2.1 (A:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg
Timeline for d1tfha2: