Lineage for d1fakt2 (1fak T:107-210)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Extracellular region of human tissue factor [49267] (2 species)
tandem of fibronectin type III domainsSpecies Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
Uniprot P13726 33-242
Domain d1fakt2: 1fak T:107-210 [21958]
Other proteins in same PDB: d1fakh_, d1faki_, d1fakl1, d1fakl2, d1fakl3
complexed with ca, fuc, glc; mutant
Details for d1fakt2
PDB Entry: 1fak (more details), 2.1 Å
PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
PDB Compounds: (T:) protein (soluble tissue factor)SCOPe Domain Sequences for d1fakt2:
Sequence, based on SEQRES records: (download)
>d1fakt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
Sequence, based on observed residues (ATOM records): (download)
>d1fakt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqkvnvtvedertlvrrnntflslrdvfgkdliytlyywgkktaktntne
flidvycfsvqavipsrtvnrkstdspvecm
SCOPe Domain Coordinates for d1fakt2:
Click to download the PDB-style file with coordinates for d1fakt2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fakt2:
View in 3D
