SCOPe 2.03: Domain d4d8ka1: 4d8k A:64-120

Lineage for d4d8ka1 (4d8k A:64-120)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (23 PDB entries)

8. Domain d4d8ka1: 4d8k A:64-120 [219572]
   Other proteins in same PDB: d4d8ka2
   automated match to d1opka1
   complexed with gol, so4

Details for d4d8ka1

PDB Entry: 4d8k, 2.36 Å

PDB Description: crystal structure of a sh3-sh2 domains of a lymphocyte-specific protein tyrosine kinase (lck) from homo sapiens at 2.36 a resolution

PDB Compounds: (A:) Tyrosine-protein kinase Lck

SCOPe Domain Sequences for d4d8ka1:

Sequence; same for both SEQRES and ATOM records:

>d4d8ka1 b.34.2.0 (A:64-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakan

Timeline for d4d8ka1:

• d4d8ka1 is new in SCOPe 2.03-stable
  
• d4d8ka1 appears in SCOPe 2.04
  
• d4d8ka1 appears in the current release, SCOPe 2.08