Lineage for d1fakt1 (1fak T:6-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371796Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2371797Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2371827Domain d1fakt1: 1fak T:6-106 [21957]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl1, d1fakl2, d1fakl3
    complexed with ca, fuc, glc; mutant

Details for d1fakt1

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
PDB Compounds: (T:) protein (soluble tissue factor)

SCOPe Domain Sequences for d1fakt1:

Sequence, based on SEQRES records: (download)

>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypageplyenspeftpylet

SCOPe Domain Coordinates for d1fakt1:

Click to download the PDB-style file with coordinates for d1fakt1.
(The format of our PDB-style files is described here.)

Timeline for d1fakt1: