Lineage for d1fakt1 (1fak T:6-106)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550879Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 550880Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 550891Domain d1fakt1: 1fak T:6-106 [21957]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl1, d1fakl2, d1fakl3

Details for d1fakt1

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant

SCOP Domain Sequences for d1fakt1:

Sequence, based on SEQRES records: (download)

>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypageplyenspeftpylet

SCOP Domain Coordinates for d1fakt1:

Click to download the PDB-style file with coordinates for d1fakt1.
(The format of our PDB-style files is described here.)

Timeline for d1fakt1: