![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (28 proteins) Pfam 00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries) |
![]() | Domain d1fakt1: 1fak T:6-106 [21957] Other proteins in same PDB: d1fakh_, d1faki_, d1fakl1, d1fakl2, d1fakl3 |
PDB Entry: 1fak (more details), 2.1 Å
SCOP Domain Sequences for d1fakt1:
Sequence, based on SEQRES records: (download)
>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpylet
>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypageplyenspeftpylet
Timeline for d1fakt1: