SCOP 1.59: Domain d1fakt1: 1fak T:6-106

Lineage for d1fakt1 (1fak T:6-106)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
Protein Extracellular region of human tissue factor [49267] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
Domain d1fakt1: 1fak T:6-106 [21957]
Other proteins in same PDB: d1fakh_, d1faki_, d1fakl1, d1fakl2, d1fakl3

Details for d1fakt1

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant

SCOP Domain Sequences for d1fakt1:

Sequence, based on SEQRES records: (download)

>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1fakt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypageplyenspeftpylet

SCOP Domain Coordinates for d1fakt1:

Click to download the PDB-style file with coordinates for d1fakt1.
(The format of our PDB-style files is described here.)

Timeline for d1fakt1: