SCOPe 2.08: Domain d4c0rb_: 4c0r B:

Lineage for d4c0rb_ (4c0r B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [224911] (1 PDB entry)

8. Domain d4c0rb_: 4c0r B: [219564]
   Other proteins in same PDB: d4c0ra2
   automated match to d4eq9a_
   complexed with cd, cl, gds

Details for d4c0rb_

PDB Entry: 4c0r, 1.55 Å

PDB Description: Molecular and structural basis of glutathione import in Gram-positive bacteria via GshT and the cystine ABC importer TcyBC of Streptococcus mutans.

PDB Compounds: (B:) putative amino acid binding protein

SCOPe Domain Sequences for d4c0rb_:

Sequence; same for both SEQRES and ATOM records:

>d4c0rb_ c.94.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
ktvtlatvgttnpfsyekkgkltgydievakevfkasdkydvkyqktewtsifsgldsdk
yqigannisytkerankylysnptasnplvlvvpkdsdiksyndiaghstqvvqgnttvp
mlqkfnknhennqvklnftsedlahqirnvsdgkydfkifekisaetiikeqgldnlkvi
dlpsdqkpyvyfifaqdqkdlqkfvnkrlkklyengtleklskkylggsylpdkkdmk

Timeline for d4c0rb_:

• d4c0rb_ first appeared in SCOPe 2.03
  
• d4c0rb_ appears in SCOPe 2.07