SCOPe 2.08: Domain d4c02b_: 4c02 B:

Lineage for d4c02b_ (4c02 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d4c02b_: 4c02 B: [219562]
   Other proteins in same PDB: d4c02a_
   automated match to d4dz3b_
   complexed with edo, flc, tak

Details for d4c02b_

PDB Entry: 4c02, 2.17 Å

PDB Description: crystal structure of human acvr1 (alk2) in complex with fkbp12.6 and dorsomorphin

PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase fkbp1b

SCOPe Domain Sequences for d4c02b_:

Sequence; same for both SEQRES and ATOM records:

>d4c02b_ d.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgf
eegaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle

Timeline for d4c02b_:

• d4c02b_ first appeared in SCOPe 2.03
  
• d4c02b_ appears in SCOPe 2.07