Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries) |
Domain d4c02b_: 4c02 B: [219562] Other proteins in same PDB: d4c02a_ automated match to d4dz3b_ complexed with edo, flc, tak |
PDB Entry: 4c02 (more details), 2.17 Å
SCOPe Domain Sequences for d4c02b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c02b_ d.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgf eegaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle
Timeline for d4c02b_: