SCOP 1.73: Domain d1boya2: 1boy A:107-213

Lineage for d1boya2 (1boy A:107-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d1boya2: 1boy A:107-213 [21956]

Details for d1boya2

PDB Entry: 1boy, 2.2 Å

PDB Description: extracellular region of human tissue factor

PDB Compounds: (A:) human tissue factor

SCOP Domain Sequences for d1boya2:

Sequence; same for both SEQRES and ATOM records:

>d1boya2 b.1.2.1 (A:107-213) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmgqe

Timeline for d1boya2:

• d1boya2 first appeared (with stable ids) in SCOP 1.55, called d1boy_2
  
• d1boya2 was called d1boy_2 in SCOP 1.71
  
• d1boya2 appears in SCOP 1.75
  
• d1boya2 appears in the current release, SCOPe 2.08