Lineage for d1boy_2 (1boy 107-213)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) Protein Extracellular region of human tissue factor [49267] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) 
Domain d1boy_2: 1boy 107-213 [21956]
Details for d1boy_2
PDB Entry: 1boy (more details), 2.2 Å
PDB Description: extracellular region of human tissue factor
SCOP Domain Sequences for d1boy_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boy_2 b.1.2.1 (107-213) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmgqe
SCOP Domain Coordinates for d1boy_2:
Click to download the PDB-style file with coordinates for d1boy_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1boy_2:
- d1boy_2 appears in SCOP 1.57
- d1boy_2 appears in the current release, SCOPe 2.08, called d1boya2
View in 3D
