SCOP 1.63: Domain d1boy_1: 1boy 3-106

Lineage for d1boy_1 (1boy 3-106)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (18 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)

8. Domain d1boy_1: 1boy 3-106 [21955]

Details for d1boy_1

PDB Entry: 1boy, 2.2 Å

PDB Description: extracellular region of human tissue factor

SCOP Domain Sequences for d1boy_1:

Sequence; same for both SEQRES and ATOM records:

>d1boy_1 b.1.2.1 (3-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltde
ivkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d1boy_1:

• d1boy_1 first appeared (with stable ids) in SCOP 1.55
  
• d1boy_1 appears in SCOP 1.61
  
• d1boy_1 appears in SCOP 1.65
  
• d1boy_1 appears in the current release, SCOPe 2.08, called d1boya1