Lineage for d1danu1 (1dan U:107-210)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) Protein Extracellular region of human tissue factor [49267] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) 
Domain d1danu1: 1dan U:107-210 [21954]
Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3
Details for d1danu1
PDB Entry: 1dan (more details), 2 Å
PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor
SCOP Domain Sequences for d1danu1:
Sequence, based on SEQRES records: (download)
>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
Sequence, based on observed residues (ATOM records): (download)
>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywsgkktakt
ntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
SCOP Domain Coordinates for d1danu1:
Click to download the PDB-style file with coordinates for d1danu1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1danu1:
View in 3D
