SCOPe 2.07: Domain d1dan.1: 1dan T:,U:91-106

Lineage for d1dan.1 (1dan T:,U:91-106)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families)
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Extracellular region of human tissue factor [49267] (2 species)
tandem of fibronectin type III domains
Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
Uniprot P13726 33-242
Domain d1dan.1: 1dan T:,U:91-106 [21953]
Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3
complexed with 0z6, bgc, ca, cac, cl, fuc

Details for d1dan.1

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

PDB Compounds: (T:) soluble tissue factor, (U:) soluble tissue factor

SCOPe Domain Sequences for d1dan.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypaXeplyenspeftpylet

SCOPe Domain Coordinates for d1dan.1:

Click to download the PDB-style file with coordinates for d1dan.1.
(The format of our PDB-style files is described here.)

Timeline for d1dan.1: