Lineage for d1dan.1 (1dan T:,U:91-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371796Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2371797Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2371810Domain d1dan.1: 1dan T:,U:91-106 [21953]
    Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3
    complexed with 0z6, bgc, ca, cac, cl, fuc

Details for d1dan.1

PDB Entry: 1dan (more details), 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor
PDB Compounds: (T:) soluble tissue factor, (U:) soluble tissue factor

SCOPe Domain Sequences for d1dan.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypaXeplyenspeftpylet

SCOPe Domain Coordinates for d1dan.1:

Click to download the PDB-style file with coordinates for d1dan.1.
(The format of our PDB-style files is described here.)

Timeline for d1dan.1: