Lineage for d1dan.1 (1dan T:,U:91-106)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54775Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 54776Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)
  8. 54779Domain d1dan.1: 1dan T:,U:91-106 [21953]
    Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3

Details for d1dan.1

PDB Entry: 1dan (more details), 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

SCOP Domain Sequences for d1dan.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypaXeplyenspeftpylet

SCOP Domain Coordinates for d1dan.1:

Click to download the PDB-style file with coordinates for d1dan.1.
(The format of our PDB-style files is described here.)

Timeline for d1dan.1: