| Class b: All beta proteins [48724] (104 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (16 proteins) |
| Protein Extracellular region of human tissue factor [49267] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) |
| Domain d1dan.1: 1dan T:,U:91-106 [21953] Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3 |
PDB Entry: 1dan (more details), 2 Å
SCOP Domain Sequences for d1dan.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1dan.1 b.1.2.1 (T:,U:91-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypaXeplyenspeftpylet
Timeline for d1dan.1: