SCOP 1.69: Domain d2hft_2: 2hft 107-211

Lineage for d2hft_2 (2hft 107-211)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (24 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d2hft_2: 2hft 107-211 [21952]

Details for d2hft_2

PDB Entry: 2hft, 1.69 Å

PDB Description: the crystal structure of the extracellular domain of human tissue factor at 1.7 angstroms resolution

SCOP Domain Sequences for d2hft_2:

Sequence, based on SEQRES records:

>d2hft_2 b.1.2.1 (107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksssqekg
efrsgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Sequence, based on observed residues (ATOM records):

>d2hft_2 b.1.2.1 (107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d2hft_2:

• d2hft_2 first appeared (with stable ids) in SCOP 1.55
  
• d2hft_2 appears in SCOP 1.67
  
• d2hft_2 appears in SCOP 1.71
  
• d2hft_2 appears in the current release, SCOPe 2.08, called d2hfta2