Lineage for d2hft_1 (2hft 1-106)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) Protein Extracellular region of human tissue factor [49267] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) 
Domain d2hft_1: 2hft 1-106 [21951]
Details for d2hft_1
PDB Entry: 2hft (more details), 1.69 Å
PDB Description: the crystal structure of the extracellular domain of human tissue factor at 1.7 angstroms resolution
SCOP Domain Sequences for d2hft_1:
Sequence, based on SEQRES records: (download)
>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet
Sequence, based on observed residues (ATOM records): (download)
>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvesteplyenspeftpylet
SCOP Domain Coordinates for d2hft_1:
Click to download the PDB-style file with coordinates for d2hft_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hft_1:
- d2hft_1 appears in SCOP 1.57
- d2hft_1 appears in the current release, SCOPe 2.08, called d2hfta1
View in 3D
