Lineage for d4bkpd_ (4bkp D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580813Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries)
  8. 1580891Domain d4bkpd_: 4bkp D: [219504]
    automated match to d4b8wa_
    complexed with edo, flc, nap

Details for d4bkpd_

PDB Entry: 4bkp (more details), 2.7 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp
PDB Compounds: (D:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4bkpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkpd_ c.2.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
fkqavketcawftdnyeqar

SCOPe Domain Coordinates for d4bkpd_:

Click to download the PDB-style file with coordinates for d4bkpd_.
(The format of our PDB-style files is described here.)

Timeline for d4bkpd_: