SCOPe 2.06: Domain d4bkpb1: 4bkp B:8-320

Lineage for d4bkpb1 (4bkp B:8-320)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d4bkpb1: 4bkp B:8-320 [219502]
   Other proteins in same PDB: d4bkpa2, d4bkpb2, d4bkpc2, d4bkpd2
   automated match to d4b8wa_
   complexed with edo, flc, nap

Details for d4bkpb1

PDB Entry: 4bkp, 2.7 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp

PDB Compounds: (B:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4bkpb1:

Sequence; same for both SEQRES and ATOM records:

>d4bkpb1 c.2.1.0 (B:8-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
tcawftdnyeqar

Timeline for d4bkpb1:

• d4bkpb1 first appeared in SCOPe 2.03, called d4bkpb_
  
• d4bkpb1 was called d4bkpb_ in SCOPe 2.05
  
• d4bkpb1 appears in SCOPe 2.07
  
• d4bkpb1 appears in the current release, SCOPe 2.08