Lineage for d1ehxa_ (1ehx A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9607Protein Cellulosomal scaffoldin protein CipC, module x2.1 [49263] (1 species)
  7. 9608Species Clostridium cellulolyticum [TaxId:1521] [49264] (1 PDB entry)
  8. 9609Domain d1ehxa_: 1ehx A: [21950]

Details for d1ehxa_

PDB Entry: 1ehx (more details)

PDB Description: nmr solution structure of the last unknown module of the cellulosomal scaffoldin protein cipc of clostridum cellulolyticum

SCOP Domain Sequences for d1ehxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehxa_ b.1.1.5 (A:) Cellulosomal scaffoldin protein CipC, module x2.1 {Clostridium cellulolyticum}
mqdptinptsisakagsfadtkitltpngntfngiselqssqytkgtnevtllasylntl
penttktltfdfgvgtknpkltitvlpkdipgle

SCOP Domain Coordinates for d1ehxa_:

Click to download the PDB-style file with coordinates for d1ehxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ehxa_: