SCOPe 2.08: Domain d1ehxa_: 1ehx A:

Lineage for d1ehxa_ (1ehx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.13: Cellulosomal scaffoldin protein CipC, module x2.1 [81293] (1 protein)
   automatically mapped to Pfam PF03442

6. Protein Cellulosomal scaffoldin protein CipC, module x2.1 [49263] (1 species)

7. Species Clostridium cellulolyticum [TaxId:1521] [49264] (1 PDB entry)

8. Domain d1ehxa_: 1ehx A: [21950]

Details for d1ehxa_

PDB Entry: 1ehx

PDB Description: nmr solution structure of the last unknown module of the cellulosomal scaffoldin protein cipc of clostridum cellulolyticum

PDB Compounds: (A:) scaffoldin protein

SCOPe Domain Sequences for d1ehxa_:

Sequence; same for both SEQRES and ATOM records:

>d1ehxa_ b.1.18.13 (A:) Cellulosomal scaffoldin protein CipC, module x2.1 {Clostridium cellulolyticum [TaxId: 1521]}
mqdptinptsisakagsfadtkitltpngntfngiselqssqytkgtnevtllasylntl
penttktltfdfgvgtknpkltitvlpkdipgle

Timeline for d1ehxa_:

• d1ehxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ehxa_ appears in SCOPe 2.07