Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries) |
Domain d4bi0a1: 4bi0 A:519-794 [219491] Other proteins in same PDB: d4bi0a2 automated match to d2qkra_ complexed with 7pe, edo, z0w |
PDB Entry: 4bi0 (more details), 2.84 Å
SCOPe Domain Sequences for d4bi0a1:
Sequence, based on SEQRES records: (download)
>d4bi0a1 d.144.1.0 (A:519-794) automated matches {Human (Homo sapiens) [TaxId: 9606]} svkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiaylnkl qqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleavhti hqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppeaikdm sssrengkskskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnheiefpd ipekdlqdvlkcclkrdpkqrisipellahpyvqiq
>d4bi0a1 d.144.1.0 (A:519-794) automated matches {Human (Homo sapiens) [TaxId: 9606]} svkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiaylnkl qqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleavhti hqhgivhsdlkpanflivdgmlklidfgianqqvgtvnymppeaikdispksdvwslgci lyymtygktpfqqiinqisklhaiidpnheiefpdipekdlqdvlkcclkrdpkqrisip ellahpyvqiq
Timeline for d4bi0a1: