Lineage for d1cvra1 (1cvr A:351-432)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770888Family b.1.18.12: Gingipain R (RgpB), C-terminal domain [81292] (1 protein)
    automatically mapped to Pfam PF03785
  6. 1770889Protein Gingipain R (RgpB), C-terminal domain [49261] (1 species)
    Arginine-specific cysteine proteinase
    follows the catalytic alpha/beta domains
  7. 1770890Species Porphyromonas gingivalis [TaxId:837] [49262] (1 PDB entry)
  8. 1770891Domain d1cvra1: 1cvr A:351-432 [21949]
    Other proteins in same PDB: d1cvra2
    complexed with ca, h37, zn

Details for d1cvra1

PDB Entry: 1cvr (more details), 2 Å

PDB Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)
PDB Compounds: (A:) gingipain r

SCOPe Domain Sequences for d1cvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvra1 b.1.18.12 (A:351-432) Gingipain R (RgpB), C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
ptemqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkve

SCOPe Domain Coordinates for d1cvra1:

Click to download the PDB-style file with coordinates for d1cvra1.
(The format of our PDB-style files is described here.)

Timeline for d1cvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cvra2