Lineage for d4bgtd2 (4bgt D:144-309)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1441214Protein automated matches [226882] (7 species)
    not a true protein
  7. 1441215Species Chloroflexus aurantiacus [TaxId:1108] [226646] (1 PDB entry)
  8. 1441217Domain d4bgtd2: 4bgt D:144-309 [219486]
    Other proteins in same PDB: d4bgta1, d4bgtd1
    automated match to d1ur5a2
    complexed with act, cd, cl, peg

Details for d4bgtd2

PDB Entry: 4bgt (more details), 1.7 Å

PDB Description: 1.70 A resolution structure of the malate dehydrogenase from Chloroflexus aurantiacus
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d4bgtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgtd2 d.162.1.1 (D:144-309) automated matches {Chloroflexus aurantiacus [TaxId: 1108]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlksl

SCOPe Domain Coordinates for d4bgtd2:

Click to download the PDB-style file with coordinates for d4bgtd2.
(The format of our PDB-style files is described here.)

Timeline for d4bgtd2:

  • d4bgtd2 is new in SCOPe 2.03-stable
  • d4bgtd2 became obsolete in SCOPe 2.04

View in 3D
Domains from same chain:
(mouse over for more information)
d4bgtd1