SCOP 1.55: Domain d1soxb1: 1sox B:344-466

Lineage for d1soxb1 (1sox B:344-466)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (23 proteins)

6. Protein Sulfite oxidase, C-terminal domain [49259] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49260] (1 PDB entry)

8. Domain d1soxb1: 1sox B:344-466 [21948]
   Other proteins in same PDB: d1soxa2, d1soxa3, d1soxb2, d1soxb3

Details for d1soxb1

PDB Entry: 1sox, 1.9 Å

PDB Description: sulfite oxidase from chicken liver

SCOP Domain Sequences for d1soxb1:

Sequence; same for both SEQRES and ATOM records:

>d1soxb1 b.1.1.5 (B:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus)}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

Timeline for d1soxb1:

• d1soxb1 appears in SCOP 1.57
  
• d1soxb1 appears in the current release, SCOPe 2.08