SCOPe 2.07: Domain d4bgfg_: 4bgf G:

Lineage for d4bgfg_ (4bgf G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein automated matches [190090] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [224915] (1 PDB entry)

8. Domain d4bgfg_: 4bgf G: [219477]
   automated match to d1gx3a_

Details for d4bgfg_

PDB Entry: 4bgf, 2.1 Å

PDB Description: the 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis

PDB Compounds: (G:) Arylamine N-acetyltransferase Nat

SCOPe Domain Sequences for d4bgfg_:

Sequence; same for both SEQRES and ATOM records:

>d4bgfg_ d.3.1.5 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
aavvdtlserfginvadigergaletride

Timeline for d4bgfg_:

• d4bgfg_ first appeared in SCOPe 2.03
  
• d4bgfg_ appears in SCOPe 2.06
  
• d4bgfg_ appears in the current release, SCOPe 2.08