Lineage for d4bgfb_ (4bgf B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399437Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 1399462Protein automated matches [190090] (4 species)
    not a true protein
  7. 1399473Species Mycobacterium tuberculosis [TaxId:83332] [224915] (1 PDB entry)
  8. 1399475Domain d4bgfb_: 4bgf B: [219472]
    automated match to d1gx3a_

Details for d4bgfb_

PDB Entry: 4bgf (more details), 2.1 Å

PDB Description: the 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis
PDB Compounds: (B:) Arylamine N-acetyltransferase Nat

SCOPe Domain Sequences for d4bgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgfb_ d.3.1.5 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
aavvdtlserfginvadigergaletride

SCOPe Domain Coordinates for d4bgfb_:

Click to download the PDB-style file with coordinates for d4bgfb_.
(The format of our PDB-style files is described here.)

Timeline for d4bgfb_: