Lineage for d4bgfa_ (4bgf A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634558Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 1634583Protein automated matches [190090] (4 species)
    not a true protein
  7. 1634594Species Mycobacterium tuberculosis [TaxId:83332] [224915] (1 PDB entry)
  8. 1634595Domain d4bgfa_: 4bgf A: [219471]
    automated match to d1gx3a_

Details for d4bgfa_

PDB Entry: 4bgf (more details), 2.1 Å

PDB Description: the 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis
PDB Compounds: (A:) Arylamine N-acetyltransferase Nat

SCOPe Domain Sequences for d4bgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgfa_ d.3.1.5 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
aavvdtlserfginvadigergaletride

SCOPe Domain Coordinates for d4bgfa_:

Click to download the PDB-style file with coordinates for d4bgfa_.
(The format of our PDB-style files is described here.)

Timeline for d4bgfa_: