SCOP 1.73: Domain d1ahka_: 1ahk A:

Lineage for d1ahka_ (1ahk A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (2 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)

8. Domain d1ahka_: 1ahk A: [21945]

Details for d1ahka_

PDB Entry: 1ahk

PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure

PDB Compounds: (A:) der f 2

SCOP Domain Sequences for d1ahka_:

Sequence; same for both SEQRES and ATOM records:

>d1ahka_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

Timeline for d1ahka_:

• d1ahka_ first appeared (with stable ids) in SCOP 1.55, called d1ahk__
  
• d1ahka_ was called d1ahk__ in SCOP 1.71
  
• d1ahka_ appears in SCOP 1.75
  
• d1ahka_ appears in the current release, SCOPe 2.08