Lineage for d1ahm__ (1ahm -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (24 proteins) 
Protein Major mite allergen [49256] (2 species) 
Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (2 PDB entries) 
Domain d1ahm__: 1ahm - [21944]
Details for d1ahm__
PDB Entry: 1ahm (more details)
PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
SCOP Domain Sequences for d1ahm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahm__ b.1.1.5 (-) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird
SCOP Domain Coordinates for d1ahm__:
Click to download the PDB-style file with coordinates for d1ahm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ahm__:
- d1ahm__ first appeared (with stable ids) in SCOP 1.55
- d1ahm__ appears in SCOP 1.59
- d1ahm__ appears in the current release, SCOPe 2.08, called d1ahma_
View in 3D