SCOPe 2.06: Domain d4bcob1: 4bco B:175-308

Lineage for d4bcob1 (4bco B:175-308)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226306] (3 PDB entries)

8. Domain d4bcob1: 4bco B:175-308 [219433]
   Other proteins in same PDB: d4bcoa1, d4bcoa2, d4bcoc1, d4bcoc2
   automated match to d2cchb1
   complexed with sgm, so4, t6q

Details for d4bcob1

PDB Entry: 4bco, 2.05 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4bcob1:

Sequence; same for both SEQRES and ATOM records:

>d4bcob1 a.74.1.1 (B:175-308) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaa

Timeline for d4bcob1:

• d4bcob1 first appeared in SCOPe 2.03
  
• d4bcob1 appears in SCOPe 2.05
  
• d4bcob1 appears in SCOPe 2.07
  
• d4bcob1 appears in the current release, SCOPe 2.08