SCOPe 2.06: Domain d4bcnd2: 4bcn D:309-431

Lineage for d4bcnd2 (4bcn D:309-431)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (10 PDB entries)

8. Domain d4bcnd2: 4bcn D:309-431 [219431]
   Other proteins in same PDB: d4bcna1, d4bcna2, d4bcnc1, d4bcnc2
   automated match to d2cchb2
   complexed with so4, t9n

Details for d4bcnd2

PDB Entry: 4bcn, 2.1 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4bcnd2:

Sequence; same for both SEQRES and ATOM records:

>d4bcnd2 a.74.1.1 (D:309-431) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslirktgytleslkpclldlhqtylkapqhaqqsirekyknskyhgvsllnppe
tln

Timeline for d4bcnd2:

• d4bcnd2 first appeared in SCOPe 2.03
  
• d4bcnd2 appears in SCOPe 2.05
  
• d4bcnd2 appears in SCOPe 2.07
  
• d4bcnd2 appears in the current release, SCOPe 2.08