![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (17 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins) |
![]() | Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49255] (3 PDB entries) |
![]() | Domain d1nfic1: 1nfi C:190-320 [21943] Other proteins in same PDB: d1nfia2, d1nfib_, d1nfic2, d1nfid_, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOP Domain Sequences for d1nfic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfic1 b.1.18.1 (C:190-320) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens)} ntaelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqva ivfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetf ksimkkspfsg
Timeline for d1nfic1: