Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.5: E set domains [49208] (27 proteins) |
Protein p65 subunit of NF-kappa B (NFKB), C-terminal domain [49253] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49255] (1 PDB entry) |
Domain d1nfic1: 1nfi C:190-320 [21943] Other proteins in same PDB: d1nfia2, d1nfib_, d1nfic2, d1nfid_, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOP Domain Sequences for d1nfic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfic1 b.1.1.5 (C:190-320) p65 subunit of NF-kappa B (NFKB), C-terminal domain {Human (Homo sapiens)} ntaelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqva ivfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetf ksimkkspfsg
Timeline for d1nfic1: