SCOPe 2.05: Domain d4bcnc_: 4bcn C:

Lineage for d4bcnc_ (4bcn C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (348 PDB entries)
   Uniprot P24941

8. Domain d4bcnc_: 4bcn C: [219429]
   Other proteins in same PDB: d4bcnb1, d4bcnb2, d4bcnd1, d4bcnd2
   automated match to d3bhta_
   complexed with so4, t9n

Details for d4bcnc_

PDB Entry: 4bcn, 2.1 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4bcnc_:

Sequence; same for both SEQRES and ATOM records:

>d4bcnc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp

Timeline for d4bcnc_:

• d4bcnc_ first appeared in SCOPe 2.03
  
• d4bcnc_ appears in SCOPe 2.04
  
• d4bcnc_ is called d4bcnc1 in SCOPe 2.06
  
• d4bcnc_ appears in the current release, SCOPe 2.08, called d4bcnc1