Lineage for d4bckc_ (4bck C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672328Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1672329Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries)
    Uniprot P24941
  8. 1672517Domain d4bckc_: 4bck C: [219423]
    Other proteins in same PDB: d4bckb1, d4bckb2, d4bckd1, d4bckd2
    automated match to d3bhta_
    complexed with sgm, t3e

Details for d4bckc_

PDB Entry: 4bck (more details), 2.05 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4bckc_:

Sequence, based on SEQRES records: (download)

>d4bckc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp

Sequence, based on observed residues (ATOM records): (download)

>d4bckc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigeygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp

SCOPe Domain Coordinates for d4bckc_:

Click to download the PDB-style file with coordinates for d4bckc_.
(The format of our PDB-style files is described here.)

Timeline for d4bckc_: