Lineage for d1nfia1 (1nfi A:190-314)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291482Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 291505Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 291509Species Human (Homo sapiens) [TaxId:9606] [49255] (3 PDB entries)
  8. 291514Domain d1nfia1: 1nfi A:190-314 [21942]
    Other proteins in same PDB: d1nfia2, d1nfib_, d1nfic2, d1nfid_, d1nfie_, d1nfif_

Details for d1nfia1

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

SCOP Domain Sequences for d1nfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfia1 b.1.18.1 (A:190-314) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens)}
ntaelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqva
ivfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetf
ksimk

SCOP Domain Coordinates for d1nfia1:

Click to download the PDB-style file with coordinates for d1nfia1.
(The format of our PDB-style files is described here.)

Timeline for d1nfia1: