Lineage for d1rama1 (1ram A:192-291)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9728Protein p65 subunit of NF-kappa B (NFKB), C-terminal domain [49253] (2 species)
  7. 9732Species Mouse (Mus musculus) [TaxId:10090] [49254] (5 PDB entries)
  8. 9738Domain d1rama1: 1ram A:192-291 [21939]
    Other proteins in same PDB: d1rama2, d1ramb2

Details for d1rama1

PDB Entry: 1ram (more details), 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

SCOP Domain Sequences for d1rama1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rama1 b.1.1.5 (A:192-291) p65 subunit of NF-kappa B (NFKB), C-terminal domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOP Domain Coordinates for d1rama1:

Click to download the PDB-style file with coordinates for d1rama1.
(The format of our PDB-style files is described here.)

Timeline for d1rama1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rama2