Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins) ECR1 - Exosome complex RNA-binding protein 1 |
Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159331] (4 PDB entries) Uniprot Q9UXC4 7-65 |
Domain d4ba1i1: 4ba1 I:6-65 [219379] Other proteins in same PDB: d4ba1a1, d4ba1a2, d4ba1a3, d4ba1b1, d4ba1b2, d4ba1i2, d4ba1i3 automated match to d2je6i2 complexed with 1pe, na, peg, po4 |
PDB Entry: 4ba1 (more details), 1.8 Å
SCOPe Domain Sequences for d4ba1i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ba1i1 b.84.4.2 (I:6-65) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} sqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg
Timeline for d4ba1i1: