Lineage for d4ba1i1 (4ba1 I:6-65)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817766Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2817817Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins)
    ECR1 - Exosome complex RNA-binding protein 1
  6. 2817818Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species)
  7. 2817823Species Sulfolobus solfataricus [TaxId:2287] [159331] (4 PDB entries)
    Uniprot Q9UXC4 7-65
  8. 2817825Domain d4ba1i1: 4ba1 I:6-65 [219379]
    Other proteins in same PDB: d4ba1a1, d4ba1a2, d4ba1a3, d4ba1b1, d4ba1b2, d4ba1i2, d4ba1i3
    automated match to d2je6i2
    complexed with 1pe, na, peg, po4

Details for d4ba1i1

PDB Entry: 4ba1 (more details), 1.8 Å

PDB Description: Archaeal exosome (Rrp4-Rrp41(D182A)-Rrp42) bound to inorganic phosphate
PDB Compounds: (I:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d4ba1i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ba1i1 b.84.4.2 (I:6-65) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
sqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg

SCOPe Domain Coordinates for d4ba1i1:

Click to download the PDB-style file with coordinates for d4ba1i1.
(The format of our PDB-style files is described here.)

Timeline for d4ba1i1: