Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Thermococcus litoralis [TaxId:2265] [226717] (2 PDB entries) |
Domain d4b8ra_: 4b8r A: [219367] automated match to d1ua4a_ complexed with dtt, gol, peg, pge, so4, trs |
PDB Entry: 4b8r (more details), 2.05 Å
SCOPe Domain Sequences for d4b8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b8ra_ c.72.1.0 (A:) automated matches {Thermococcus litoralis [TaxId: 2265]} mkeslkdrirlwkrlyvnafenalnaipnvkgvllayntnidaikyldkddlekrvteig kekvfeiienppekissieellggilrsiklgkamewfveseevrrylrewgwdelrigg qagimanllggvyriptivhvpqnpklqaelfvdgpiyvpvfegnklklvhpkdaiaeee elihyiyefprgfqvfdvqaprenrfianaddynarvymrrefregfeeitrnvelaiis glqvlkeyypdgttyrdvldrveshlnilnrynvkshfefaytanrrvrealvellpkft svglnevelasimeiigdeelakevleghifsvidamnvlmdetgierihfhtygyylal tqyrgeevrdallfaslaaaakamkgnlerieqirdalsvptneraivleeelekeftef englidmvdrqlafvptkivaspkstvgigdtisssafvsefgmrkr
Timeline for d4b8ra_: