Lineage for d4b7ub2 (4b7u B:165-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938897Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (13 PDB entries)
  8. 1938908Domain d4b7ub2: 4b7u B:165-330 [219359]
    Other proteins in same PDB: d4b7ua1, d4b7ub1, d4b7uc1, d4b7ud1
    automated match to d1t2da2
    complexed with bcn, ca, edo, mpd

Details for d4b7ub2

PDB Entry: 4b7u (more details), 1.88 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with bicine
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4b7ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b7ub2 d.162.1.1 (B:165-330) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkalah

SCOPe Domain Coordinates for d4b7ub2:

Click to download the PDB-style file with coordinates for d4b7ub2.
(The format of our PDB-style files is described here.)

Timeline for d4b7ub2: