SCOPe 2.03: Domain d4b7ia1: 4b7i A:237-339

Lineage for d4b7ia1 (4b7i A:237-339)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d4b7ia1: 4b7i A:237-339 [219352]
   automated match to d2ql1a1
   complexed with cl

Details for d4b7ia1

PDB Entry: 4b7i, 2.36 Å

PDB Description: crystal structure of human igg fc bearing hybrid-type glycans

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4b7ia1:

Sequence; same for both SEQRES and ATOM records:

>d4b7ia1 b.1.1.2 (A:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d4b7ia1:

• d4b7ia1 is new in SCOPe 2.03-stable
  
• d4b7ia1 appears in SCOPe 2.04
  
• d4b7ia1 appears in the current release, SCOPe 2.08