SCOPe 2.03: Domain d4b5eb_: 4b5e B:

Lineage for d4b5eb_ (4b5e B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d4b5eb_: 4b5e B: [219337]
   automated match to d4aq1b_
   complexed with gol, so4

Details for d4b5eb_

PDB Entry: 4b5e, 1.94 Å

PDB Description: crystal structure of an amyloid-beta binding single chain antibody ps2-8

PDB Compounds: (B:) ps2-8

SCOPe Domain Sequences for d4b5eb_:

Sequence; same for both SEQRES and ATOM records:

>d4b5eb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrsfsrdamgwfrqapgkerdvvaainlnggrtys
adsvkgrftisrdndkntvylqmsnlkpedtavyycaaregdvglvsykrssnypywgqg
tqvtvss

Timeline for d4b5eb_:

• d4b5eb_ is new in SCOPe 2.03-stable
  
• d4b5eb_ appears in SCOPe 2.04
  
• d4b5eb_ appears in the current release, SCOPe 2.08