Lineage for d1a3qb1 (1a3q B:227-327)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9724Protein p52 subunit of NF-kappa B (NFKB), C-terminal domain [49251] (1 species)
  7. 9725Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry)
  8. 9727Domain d1a3qb1: 1a3q B:227-327 [21933]
    Other proteins in same PDB: d1a3qa2, d1a3qb2

Details for d1a3qb1

PDB Entry: 1a3q (more details), 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna
PDB Compounds: (B:) protein (nuclear factor kappa-b p52)

SCOP Domain Sequences for d1a3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3qb1 b.1.1.5 (B:227-327) p52 subunit of NF-kappa B (NFKB), C-terminal domain {Human (Homo sapiens)}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp

SCOP Domain Coordinates for d1a3qb1:

Click to download the PDB-style file with coordinates for d1a3qb1.
(The format of our PDB-style files is described here.)

Timeline for d1a3qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3qb2