Lineage for d1vkxb1 (1vkx B:547-650)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160814Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species)
  7. 160819Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)
  8. 160824Domain d1vkxb1: 1vkx B:547-650 [21931]
    Other proteins in same PDB: d1vkxa1, d1vkxa2, d1vkxb2

Details for d1vkxb1

PDB Entry: 1vkx (more details), 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

SCOP Domain Sequences for d1vkxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkxb1 b.1.1.5 (B:547-650) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1vkxb1:

Click to download the PDB-style file with coordinates for d1vkxb1.
(The format of our PDB-style files is described here.)

Timeline for d1vkxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkxb2