Lineage for d1nfka1 (1nfk A:251-350)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160814Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species)
  7. 160819Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)
  8. 160822Domain d1nfka1: 1nfk A:251-350 [21929]
    Other proteins in same PDB: d1nfka2, d1nfkb2

Details for d1nfka1

PDB Entry: 1nfk (more details), 2.3 Å

PDB Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer

SCOP Domain Sequences for d1nfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfka1 b.1.1.5 (A:251-350) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1nfka1:

Click to download the PDB-style file with coordinates for d1nfka1.
(The format of our PDB-style files is described here.)

Timeline for d1nfka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfka2