SCOP 1.59: Domain d1iknc_: 1ikn C:

Lineage for d1iknc_ (1ikn C:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (25 proteins)

6. Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)

8. Domain d1iknc_: 1ikn C: [21928]
   Other proteins in same PDB: d1ikna1, d1ikna2, d1iknd_

Details for d1iknc_

PDB Entry: 1ikn, 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex

SCOP Domain Sequences for d1iknc_:

Sequence; same for both SEQRES and ATOM records:

>d1iknc_ b.1.1.5 (C:) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev

Timeline for d1iknc_:

• d1iknc_ first appeared (with stable ids) in SCOP 1.55
  
• d1iknc_ appears in SCOP 1.57
  
• d1iknc_ appears in SCOP 1.61
  
• d1iknc_ appears in the current release, SCOPe 2.08