SCOPe 2.06: Domain d4b41b_: 4b41 B:

Lineage for d4b41b_ (4b41 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d4b41b_: 4b41 B: [219278]
   automated match to d3ezjb_
   complexed with cl, gol

Details for d4b41b_

PDB Entry: 4b41, 1.19 Å

PDB Description: Crystal structure of an amyloid-beta binding single chain antibody G7

PDB Compounds: (B:) antibody g7

SCOPe Domain Sequences for d4b41b_:

Sequence; same for both SEQRES and ATOM records:

>d4b41b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqpggslrlscaasrsiisnnamgwyrqapgkqrelvarissggrttyad
svkgrftisrdnakttvylqmnslkpedtavyycnaaslvrgpldhwgqgtqvtvss

Timeline for d4b41b_:

• d4b41b_ first appeared in SCOPe 2.03
  
• d4b41b_ appears in SCOPe 2.05
  
• d4b41b_ appears in SCOPe 2.07
  
• d4b41b_ appears in the current release, SCOPe 2.08